PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010918221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 211aa    MW: 24714.5 Da    PI: 9.8127
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010918221.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.71e-48341603128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yL++ v gkkl++ ++i ++++y+++Pw+Lp  +k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+++ s+  
  XP_010918221.1  34 PGFRFHPTEEELLDFYLRRVVFGKKLNF-DIIGTLNLYRHDPWELPGLAKIGEREWYFFVPRDRKSGNGGRPNRTTERGFWKATGSDRQIRSAad 127
                     9*************************99.99***************8888899**************************************9877 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++l+glkktLvfy+grap+g+ktdWvm+eyrl
  XP_010918221.1 128 PKRLIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 160
                     7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.16832205IPR003441NAC domain
SuperFamilySSF1019411.83E-5332165IPR003441NAC domain
PfamPF023652.7E-2534160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MNTWSLCRRE SQGKDRAELT LCIMEGSGSE LDLPGFRFHP TEEELLDFYL RRVVFGKKLN  60
FDIIGTLNLY RHDPWELPGL AKIGEREWYF FVPRDRKSGN GGRPNRTTER GFWKATGSDR  120
QIRSAADPKR LIGLKKTLVF YQGRAPRGTK TDWVMNEYRL PDAPHPIPNS IPPPKVPPLP  180
HTIHPYTRMC INPYKYMHVC VYMYQFYMYL G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-472916011140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918221.11e-158PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW53e-55NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLJ3LJN82e-87J3LJN8_ORYBR; Uncharacterized protein
STRINGOB03G12640.14e-87(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-75NAC domain containing protein 36